PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 91900
Common NameABI5B-1, SELMODRAFT_91900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 296aa    MW: 32632.5 Da    PI: 6.9814
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
91900genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.77.1e-15245286546
             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
             +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk
   91900 245 RRQRRMIKNRESAARSRARKQAYTVELEAELTQLKEENTRLK 286
             79*************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.2E-8241292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921243295IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.4E-14245287No hitNo description
PfamPF001702.5E-12245286IPR004827Basic-leucine zipper domain
CDDcd147071.19E-25245295No hitNo description
SuperFamilySSF579591.56E-10245287No hitNo description
PROSITE patternPS000360248263IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MLHPPPNGGV GPQRSGLGRQ GSIYSLTLEE LQNSMLDQGK IGSMNMDEFM KNVWTAEENQ  60
GGAANTNTST ATSTATDNPP APSSLQRQSS VSIPRTLSQK TVDEVWKEIQ VQKQQQQQQD  120
LSYGEMTLED FLIRAGVVKE DTDATSGGVV QAIGPQGTIP NSIDSMAQNP DWYNYQVKQQ  180
QLMHQAADFS KRPNLIVPAG HPGAFFDAPY DAVPSSLALS PGMATPEAPG KKRSLDLVVE  240
KTVERRQRRM IKNRESAARS RARKQAYTVE LEAELTQLKE ENTRLKRWQV RLDHS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00087SELEXTransfer from AT1G49720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002969410.10.0hypothetical protein SELMODRAFT_91900
TrEMBLD8RET60.0D8RET6_SELML; Putative uncharacterized protein ABI5B-1
STRINGEFJ294980.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-49ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]